· An explanation grounded in the cited sources
MCM2 · P49736
On this page
Meet the protein
MCM2 is UniProt protein record P49736 for Homo sapiens (NCBI 9606). The retained sequence contains 904 amino acids.
[1]What is known about function
Function and evidence from UniProt
Inspect structured data
- source text
- Acts as a component of the MCM2-7 complex (MCM complex) which is the replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. Core component of CDC45-MCM-GINS (CMG) helicase, the molecular machine that unwinds template DNA during replication, and around which the replisome is built (PubMed:32453425, PubMed:34694004, PubMed:34700328, PubMed:35585232). The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity (PubMed:32453425). Required for the entry in S phase and for cell division (PubMed:8175912). Plays a role in terminally differentiated hair cells development of the cochlea and induces cells apoptosis (PubMed:26196677)
- source language
- en
- evidence codes
- evidenceCode
- ECO:0000269
- source
- PubMed
- id
- 26196677
- evidenceCode
- ECO:0000269
- source
- PubMed
- id
- 32453425
- evidenceCode
- ECO:0000269
- source
- PubMed
- id
- 34694004
- evidenceCode
- ECO:0000269
- source
- PubMed
- id
- 34700328
- evidenceCode
- ECO:0000269
- source
- PubMed
- id
- 35585232
- evidenceCode
- ECO:0000269
- source
- PubMed
- id
- 8175912
Evidence for this statement
Source annotation
Evidence codes qualify the annotation. This record is not a measurement of an illustrated specimen.
Sequence and version
P49736
Inspect structured data
- accession
- P49736
- name
- DNA replication licensing factor MCM2
- length
- 904
- entry version
- 249
- sequence version
- 4
- sequence
MAESSESFTMASSPAQRRRGNDPLTSSPGRSSRRTDALTSSPGRDLPPFEDESEGLLGTE GPLEEEEDGEELIGDGMERDYRAIPELDAYEAEGLALDDEDVEELTASQREAAERAMRQR DREAGRGLGRMRRGLLYDSDEEDEERPARKRRQVERATEDGEEDEEMIESIENLEDLKGH SVREWVSMAGPRLEIHHRFKNFLRTHVDSHGHNVFKERISDMCKENRESLVVNYEDLAAR EHVLAYFLPEAPAELLQIFDEAALEVVLAMYPKYDRITNHIHVRISHLPLVEELRSLRQL HLNQLIRTSGVVTSCTGVLPQLSMVKYNCNKCNFVLGPFCQSQNQEVKPGSCPECQSAGP FEVNMEETIYQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHN NYDGSLNTANGFPVFATVILANHVAKKDNKVAVGELTDEDVKMITSLSKDQQIGEKIFAS IAPSIYGHEDIKRGLALALFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYIEKVS SRAIFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSI HEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDIL CVVRDTVDPVQDEMLARFVVGSHVRHHPSNKEEEGLANGSAAEPAMPNTYGVEPLPQEVL KKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESMATGSIPITVRHIESMIRMAEAHARI HLRDYVIEDDVNMAIRVMLESFIDTQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLV AEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMI LQQF
Genes and domains
Cross-references supplied by UniProt
Inspect structured data
- gene symbols
- MCM2
- gene crossreferences
- database
- Ensembl
- id
- ENST00000265056.12
- properties
- key
- ProteinId
- value
- ENSP00000265056.7
- key
- GeneId
- value
- ENSG00000073111.16
- database
- GeneID
- id
- 4171
- properties
- key
- Description
- value
- -
- interpro domains
- provider
- interpro
- accession
- IPR031327
- name
- MCM
- provider
- interpro
- accession
- IPR008045
- name
- MCM2
- provider
- interpro
- accession
- IPR061506
- name
- MCM2_N
- provider
- interpro
- accession
- IPR018525
- name
- MCM_CS
- provider
- interpro
- accession
- IPR001208
- name
- MCM_dom
- provider
- interpro
- accession
- IPR041562
- name
- MCM_lid
- provider
- interpro
- accession
- IPR027925
- name
- MCM_N
- provider
- interpro
- accession
- IPR033762
- name
- MCM_OB
- provider
- interpro
- accession
- IPR012340
- name
- NA-bd_OB-fold
- provider
- interpro
- accession
- IPR027417
- name
- P-loop_NTPase
- provider
- interpro
- accession
- IPR059098
- name
- WHD_MCM2
GO function annotations
A sample with evidence codes
Inspect structured data
Shown / materialized / in provider response: 12 / 126 / 126
| GO | Evidence | Publication or rule | Assigned by |
|---|---|---|---|
| GO:0005730 nucleolus Cellular Component | ECO:0000314 NOT|located_in | PMID:21383955 | UniProt 20170426 |
| GO:0017116 single-stranded DNA helicase activity Molecular Function | ECO:0000318 contributes_to | GO_REF:0000033 | GO_Central 20210414 |
| GO:0043138 3'-5' DNA helicase activity Molecular Function | ECO:0000318 contributes_to | GO_REF:0000033 | GO_Central 20190210 |
| GO:0003677 DNA binding Molecular Function | ECO:0000256 enables | GO_REF:0000002 | InterPro 20260727 |
| GO:0003677 DNA binding Molecular Function | ECO:0000304 enables | PMID:8175912 | PINC 20030904 |
| GO:0003678 DNA helicase activity Molecular Function | ECO:0000501 enables | GO_REF:0000120 | UniProt 20260727 |
| GO:0003688 DNA replication origin binding Molecular Function | ECO:0000265 enables | GO_REF:0000107 | Ensembl 20260724 |
| GO:0003697 single-stranded DNA binding Molecular Function | ECO:0000318 enables | GO_REF:0000033 | GO_Central 20230110 |
| GO:0005515 protein binding Molecular Function | ECO:0000353 enables | PMID:11095689 | UniProt 20070220 |
| GO:0005515 protein binding Molecular Function | ECO:0000353 enables | PMID:12740381 | IntAct 20260725 |
| GO:0005515 protein binding Molecular Function | ECO:0000353 enables | PMID:15232106 | IntAct 20260725 |
| GO:0005515 protein binding Molecular Function | ECO:0000353 enables | PMID:15232106 | IntAct 20260725 |
Evidence for this statement
Source annotation
- Gene Ontology Consortium / QuickGO · UniProtKB:P49736
- Gene Ontology Consortium / QuickGO · UniProtKB:P49736
These are source annotations, not independent proof of a causal mechanism. The complete captured responses are available as originals.
Research cited by the protein record
Bibliographic records
Inspect structured data
- source
- uniprot
- id
- P49736-citation-8175912
- title
- A human nuclear protein with sequence homology to a family of early S phase proteins is required for entry into S phase and for cell division.
- pmid
- 8175912
- doi
- 10.1242/jcs.107.1.253
- year
- 1994
- authors
- Todorov I.T.
- Pepperkok R.
- Philipova R.N.
- Kearsey S.E.
- Ansorge W.
- Werner D.
- journal
- J. Cell Sci.
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/P49736.json
- source snapshot sha256
- 6d1b85a1e548c32f74248e487f6817342ecc7e523b6a7933520c9700d188356f
- source
- uniprot
- id
- P49736-citation-7584026
- title
- Prediction of the coding sequences of unidentified human genes. I. The coding sequences of 40 new genes (KIAA0001-KIAA0040) deduced by analysis of randomly sampled cDNA clones from human immature myeloid cell line KG-1.
- pmid
- 7584026
- doi
- 10.1093/dnares/1.1.27
- year
- 1994
- authors
- Nomura N.
- Miyajima N.
- Sazuka T.
- Tanaka A.
- Kawarabayasi Y.
- Sato S.
- Nagase T.
- Seki N.
- Ishikawa K.
- Tabata S.
- journal
- DNA Res.
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/P49736.json
- source snapshot sha256
- 6d1b85a1e548c32f74248e487f6817342ecc7e523b6a7933520c9700d188356f
- source
- uniprot
- id
- P49736-citation-15489334
- title
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
- pmid
- 15489334
- doi
- 10.1101/gr.2596504
- year
- 2004
- authors
- journal
- Genome Res.
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/P49736.json
- source snapshot sha256
- 6d1b85a1e548c32f74248e487f6817342ecc7e523b6a7933520c9700d188356f
- source
- uniprot
- id
- P49736-citation-CI-D7CASS6KHIPA6
- title
- Homo sapiens DNA replication licensing factor (huMCM2).
- pmid
- —
- doi
- —
- year
- MAR-
- authors
- Mimura S.
- Nishimoto S.
- Kubota Y.
- Takisawa H.
- Nojima H.
- journal
- —
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/P49736.json
- source snapshot sha256
- 6d1b85a1e548c32f74248e487f6817342ecc7e523b6a7933520c9700d188356f
- source
- uniprot
- id
- P49736-citation-CI-4IUTBOVVGSAD8
- title
- Cloning of human full-length CDSs in BD Creator(TM) system donor vector.
- pmid
- —
- doi
- —
- year
- AUG-
- authors
- Kalnine N.
- Chen X.
- Rolfs A.
- Halleck A.
- Hines L.
- Eisenstein S.
- Koundinya M.
- Raphael J.
- Moreira D.
- Kelley T.
- LaBaer J.
- Lin Y.
- Phelan M.
- Farmer A.
- journal
- —
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/P49736.json
- source snapshot sha256
- 6d1b85a1e548c32f74248e487f6817342ecc7e523b6a7933520c9700d188356f
- source
- uniprot
- id
- P49736-citation-8258304
- title
- The human gene for nuclear protein BM28 (CDCL1), a new member of the early S-phase family of proteins, maps to chromosome band 3q21.
- pmid
- 8258304
- doi
- 10.1159/000133647
- year
- 1994
- authors
- Mincheva A.
- Todorov I.T.
- Werner D.
- Fink T.M.
- Lichter P.
- journal
- Cytogenet. Cell Genet.
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/P49736.json
- source snapshot sha256
- 6d1b85a1e548c32f74248e487f6817342ecc7e523b6a7933520c9700d188356f
- source
- uniprot
- id
- P49736-citation-9305914
- title
- A DNA helicase activity is associated with an MCM4, -6, and -7 protein complex.
- pmid
- 9305914
- doi
- 10.1074/jbc.272.39.24508
- year
- 1997
- authors
- Ishimi Y.
- journal
- J. Biol. Chem.
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/P49736.json
- source snapshot sha256
- 6d1b85a1e548c32f74248e487f6817342ecc7e523b6a7933520c9700d188356f
- source
- uniprot
- id
- P49736-citation-11095689
- title
- The human homolog of Saccharomyces cerevisiae Mcm10 interacts with replication factors and dissociates from nuclease-resistant nuclear structures in G(2) phase.
- pmid
- 11095689
- doi
- 10.1093/nar/28.23.4769
- year
- 2000
- authors
- Izumi M.
- Yanagi K.
- Mizuno T.
- Yokoi M.
- Kawasaki Y.
- Moon K.Y.
- Hurwitz J.
- Yatagai F.
- Hanaoka F.
- journal
- Nucleic Acids Res.
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/P49736.json
- source snapshot sha256
- 6d1b85a1e548c32f74248e487f6817342ecc7e523b6a7933520c9700d188356f
- source
- uniprot
- id
- P49736-citation-15210935
- title
- Minichromosome maintenance proteins are direct targets of the ATM and ATR checkpoint kinases.
- pmid
- 15210935
- doi
- 10.1073/pnas.0403410101
- year
- 2004
- authors
- Cortez D.
- Glick G.
- Elledge S.J.
- journal
- Proc. Natl. Acad. Sci. U.S.A.
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/P49736.json
- source snapshot sha256
- 6d1b85a1e548c32f74248e487f6817342ecc7e523b6a7933520c9700d188356f
- source
- uniprot
- id
- P49736-citation-17081983
- title
- Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
- pmid
- 17081983
- doi
- 10.1016/j.cell.2006.09.026
- year
- 2006
- authors
- Olsen J.V.
- Blagoev B.
- Gnad F.
- Macek B.
- Kumar C.
- Mortensen P.
- Mann M.
- journal
- Cell
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/P49736.json
- source snapshot sha256
- 6d1b85a1e548c32f74248e487f6817342ecc7e523b6a7933520c9700d188356f
- source
- uniprot
- id
- P49736-citation-16899510
- title
- Essential role of phosphorylation of MCM2 by Cdc7/Dbf4 in the initiation of DNA replication in mammalian cells.
- pmid
- 16899510
- doi
- 10.1091/mbc.e06-03-0241
- year
- 2006
- authors
- Tsuji T.
- Ficarro S.B.
- Jiang W.
- journal
- Mol. Biol. Cell
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/P49736.json
- source snapshot sha256
- 6d1b85a1e548c32f74248e487f6817342ecc7e523b6a7933520c9700d188356f
- source
- uniprot
- id
- P49736-citation-16387653
- title
- ING tumor suppressor proteins are critical regulators of chromatin acetylation required for genome expression and perpetuation.
- pmid
- 16387653
- doi
- 10.1016/j.molcel.2005.12.007
- year
- 2006
- authors
- Doyon Y.
- Cayrou C.
- Ullah M.
- Landry A.-J.
- Cote V.
- Selleck W.
- Lane W.S.
- Tan S.
- Yang X.-J.
- Cote J.
- journal
- Mol. Cell
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/P49736.json
- source snapshot sha256
- 6d1b85a1e548c32f74248e487f6817342ecc7e523b6a7933520c9700d188356f
Evidence for this statement
Source annotation
Only metadata is shown. Article text has a separate reuse decision.
Organism in the UniProt record
Homo sapiens · NCBI 9606Scientific profile →Your research question
Save the article to return to your question and this source version.
Plan a test
This is your research plan. Completing these fields does not confirm a hypothesis.
Sources and versions
An explanation grounded in the cited sources
- UniProt Consortium · P49736
2026-09-09T03:19:37.652260+00:00 · CC-BY-4.0
Provenance and original
- Source version
- entry 249; sequence 4
- Original SHA-256
- 6d1b85a1e548c32f74248e487f6817342ecc7e523b6a7933520c9700d188356f
- Processing
- Unmodified provider response; selected fields are projected into the document.
- Version details
- Native entry and sequence versions retained.
- Gene Ontology Consortium / QuickGO · UniProtKB:P49736
2026-09-09T03:19:38.868150+00:00 · CC-BY-4.0
Provenance and original
- Original SHA-256
- 03e6f92c3168330f8946e992b513d8ce36cb88cc515fb8b994786586182c74a4
- Processing
- Unmodified provider response; selected fields are projected into the document.
- Version details
- No native GO release was supplied; exact response hash and retrieval time are retained.
- Gene Ontology Consortium / QuickGO · UniProtKB:P49736
2026-09-09T03:19:39.500632+00:00 · CC-BY-4.0
Provenance and original
- Original SHA-256
- f04c287bd242718906bc146fd64c51d2efb2c5a3e215f77414c83d78350af922
- Processing
- Unmodified provider response; selected fields are projected into the document.
- Version details
- No native GO release was supplied; exact response hash and retrieval time are retained.
Inspect structured data
- Content version
- c440ca2667559f68702ce349d0e8c5d825ca6125e7bc68dad2eccd3e415e4646
- Source version
- research-20260909.1
- Updated
- 2026-09-09