· An explanation grounded in the cited sources
D1 protein · PsbA
On this page
How it works
P83755 is the photosystem II D1 protein record for Arabidopsis thaliana, NCBI Taxonomy 3702. The retained UniProt version identifies psbA / AtCg00020 and a sequence of 353 amino acids.
[1]The retained entry version is 161 and sequence version is 2. Its annotation was updated on 2 September 2026; the sequence was last changed on 23 January 2007. These are separate events.
[1]Function and location are model-based annotations: ECO:0000255, HAMAP MF_01379. The original JSON contains the sequence, protein features, references and evidence codes. Anatomy photographs are separate materials and do not establish the provenance of this sequence.
[1]Protein sequence
P83755 · 353 aa · sequence 2
Inspect structured data
- accession
- P83755
- sequence version
- 2
- length
- 353
- sequence
MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAAVEAPSTNG
Connected concepts
Continue with an organism
The photographs and molecular record come from separate source materials.
Your research question
Save the article to return to your question and this source version.
Plan a test
This is your research plan. Completing these fields does not confirm a hypothesis.
Sources and versions
An explanation grounded in the cited sources
- UniProt P83755 · entry 161 / sequence 2
2026-09-09T01:17:34.554931+00:00 · CC-BY-4.0
Provenance and original
- Source version
- entry 161; sequence 2
- Original SHA-256
- f16a5f33fbf85a12aa5c91ab31f6092f0bbe3be874040c84c4954e87b20ae3a9
- Processing
- Unmodified provider response; article text is an attributed educational summary.
- Version details
- Provider entry/sequence versions retained.
- GO:0009523 · photosystem II
2026-09-09T01:17:35.068503+00:00 · CC-BY-4.0
Provenance and original
- Original SHA-256
- 56537702684f4e6949eb9b16430a8830740bc9fd3369b21e7b5a9b711a341b4f
- Processing
- Unmodified provider response; article text is an attributed educational summary.
- Version details
- QuickGO response did not supply a native ontology release; retrieval time and exact response hash retained.
- GO:0009507 · chloroplast
2026-09-09T01:17:34.931415+00:00 · CC-BY-4.0
Provenance and original
- Original SHA-256
- 13082607c7dcc9e92cd281f1fc6a8fdf2878bceba74e9d7b6ad50d43b0ce33ba
- Processing
- Unmodified provider response; article text is an attributed educational summary.
- Version details
- QuickGO response did not supply a native ontology release; retrieval time and exact response hash retained.
- Arabidopsis thaliana, first leaf of control seedling grown without added NaCl; Figure 3A
Retrieval date unknown · CC BY 4.0
Provenance and original
- Original SHA-256
- fe305c7d3a3327a06dda04c186989b5b8b6dec101bfe13aa851a3bc47dc07b14
- Processing
- Panel A extracted; original g/t annotations and 1 µm scale retained; encoded as WebP.
Inspect structured data
- Content version
- eef4f32989458e93671b2c6ea7c4914d7da2ef538e1104c5caa484987eae1741
- Source version
- knowledge-20260909.1
- Updated
- 2026-09-09