← Back to reading

D1 protein · PsbA

In brief

D1 is one of the central proteins of photosystem II. Together with D2 it provides a framework for light-driven electron transfer. The retained Arabidopsis UniProt entry links D1 to psbA and AtCg00020. This page connects that biological role with an exact 353-amino-acid sequence and its model-based annotation. [1] [2]

Evidence for this statement

Source-based explanation

Where to check this statement

uniprot-P83755
UniProt FUNCTION; GO term definition
go-photosystem2
UniProt FUNCTION; GO term definition
Read the section →
Save, investigate and check this version

Editorial draft · human review pending

Ask about this material
On this page

A protein of the photosystem II reaction centre

The retained entry version is 161 and sequence version is 2. Its annotation was updated on 2 September 2026; the sequence was last changed on 23 January 2007. These are separate events.

[1]
Evidence for this statement

Source-based explanation

Where to check this statement

uniprot-P83755
Captured UniProt JSON: primaryAccession, organism, sequence and FUNCTION comments

Function and location are model-based annotations: ECO:0000255, HAMAP MF_01379. The original JSON contains the sequence, protein features, references and evidence codes. Anatomy photographs are separate materials and do not establish the provenance of this sequence.

[1]
Evidence for this statement

Source-based explanation

Where to check this statement

uniprot-P83755
Captured UniProt JSON: primaryAccession, organism, sequence and FUNCTION comments

Sequence and activity answer different questions

The D1/D2 reaction-centre pair belongs to the machinery transferring electrons from water to plastoquinone. A sequence comparison asks which amino acids are present in D1. An activity measurement asks how the complete photosystem works under stated conditions. The retained sequence and FUNCTION annotation describe identity and expected role; the displayed photographs provide no activity measurement.

[1] [2]
Evidence for this statement

EcoGenesis

Where to check this statement

uniprot-P83755
GO definition / UniProt FUNCTION / original figure caption, as applicable
go-photosystem2
GO definition / UniProt FUNCTION / original figure caption, as applicable

Three different identifiers

P83755 identifies the UniProt protein entry; psbA is the linked gene symbol and AtCg00020 the locus name in the retained record. These identifiers are related, not interchangeable. Sequence version is an additional requirement: the same name does not guarantee the same amino-acid string.

[1]
Evidence for this statement

Explanation of retained sources

Where to check this statement

uniprot-P83755
Captured provider JSON; named selected record and native source versions

Entry and sequence versions

Entry version 161 and sequence version 2 track different changes. Annotation can change without replacing the amino-acid sequence. For a reproducible comparison, preserve accession, both versions and the available original JSON checksum; retrieval date does not replace those values.

[1]
Evidence for this statement

Explanation of retained sources

Where to check this statement

uniprot-P83755
Captured provider JSON; named selected record and native source versions

Annotation and observation

The named ECO:0000255 code is linked to a HAMAP model rule in this record. Inspect the evidence for the chosen field rather than only the entry heading. A leaf photograph, chloroplast micrograph and D1 sequence are separate materials; placing them together does not establish origin in one specimen.

[1] [4]
Evidence for this statement

Explanation of retained sources

Where to check this statement

uniprot-P83755
Captured provider JSON; named selected record and native source versions

Protein sequence

P83755 · 353 aa · sequence 2

Inspect structured data
accession
P83755
sequence version
2
length
353
Sequence
MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI
DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL
LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF
NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG
QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF
NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAAVEAPSTNG
[1]
Evidence for this statement

UniProt source record

Where to check this statement

uniprot-P83755
Captured UniProt JSON: sequence.value, sequence.length, sequenceVersion and entryVersion

Connected concepts

Photosystem II

Photosystem II is a molecular complex associated with pigments and electron carriers. In chloroplasts and cyanobacteria it uses light to transfer electrons from water to plastoquinone.

[2] [1]
Evidence for this statement

Source-based explanation

Where to check this statement

go-photosystem2
Captured GO ontology JSON: results[].id and definition.text
uniprot-P83755
Captured provider JSON; named selected record and native source versions
Chloroplast

A chloroplast is a chlorophyll-containing plastid. It contains thylakoids and stroma, with some thylakoids organised into stacks called grana.

[3] [4] [1]
Evidence for this statement

Source-based explanation

Where to check this statement

go-chloroplast
Captured GO ontology JSON: results[].id and definition.text
uniprot-P83755
Captured provider JSON; named selected record and native source versions

Continue with an organism

The photographs and molecular record come from separate source materials.

Norway spruce →Arabidopsis thaliana →

Your research question

Save the article to return to your question and this source version.

Plan a test

This is your research plan. Completing these fields does not confirm a hypothesis.

Ask about this material

Sources and versions

Editorial draft · human review pending

  1. UniProt P83755 · entry 161 / sequence 2

    2026-09-09T01:17:34.554931+00:00 · CC-BY-4.0

    Provenance and original
    Source version
    entry 161; sequence 2
    Original SHA-256
    f16a5f33fbf85a12aa5c91ab31f6092f0bbe3be874040c84c4954e87b20ae3a9
    Processing
    Unmodified provider response; article text is an attributed educational summary.
    Version details
    Provider entry/sequence versions retained.

    View original JSON · Download original

  2. GO:0009523 · photosystem II

    2026-09-09T01:17:35.068503+00:00 · CC-BY-4.0

    Provenance and original
    Original SHA-256
    56537702684f4e6949eb9b16430a8830740bc9fd3369b21e7b5a9b711a341b4f
    Processing
    Unmodified provider response; article text is an attributed educational summary.
    Version details
    QuickGO response did not supply a native ontology release; retrieval time and exact response hash retained.

    View original JSON · Download original

  3. GO:0009507 · chloroplast

    2026-09-09T01:17:34.931415+00:00 · CC-BY-4.0

    Provenance and original
    Original SHA-256
    13082607c7dcc9e92cd281f1fc6a8fdf2878bceba74e9d7b6ad50d43b0ce33ba
    Processing
    Unmodified provider response; article text is an attributed educational summary.
    Version details
    QuickGO response did not supply a native ontology release; retrieval time and exact response hash retained.

    View original JSON · Download original

  4. Arabidopsis thaliana, first leaf of control seedling grown without added NaCl; Figure 3A

    Retrieval date unknown · CC BY 4.0

    Provenance and original
    Original SHA-256
    fe305c7d3a3327a06dda04c186989b5b8b6dec101bfe13aa851a3bc47dc07b14
    Processing
    Panel A extracted; original g/t annotations and 1 µm scale retained; encoded as WebP.
Inspect structured data
Content version
4f7e3e29a6f380ad43d4dfcef887aa435cafbbc73da20acea7385f5cb014a832
Source version
knowledge-20260909.1
Updated
2026-10-01