· An explanation grounded in the cited sources
CDC28 · P00546
On this page
Meet the protein
CDC28 is UniProt protein record P00546 for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (NCBI 559292). The retained sequence contains 298 amino acids.
[1]What is known about function
Function and evidence from UniProt
Inspect structured data
- source text
- Cyclin-dependent kinase that acts as a master regulator of the mitotic and meiotic cell cycles (By similarity). Required to drive the G1-S transition (PubMed:2664468). More than 200 substrates have been identified (PubMed:14574415). Substrate specificity is in part regulated by the bound cyclin protein (By similarity). Phosphorylates YTA7 during S-phase to promote transcription of histones (PubMed:22156209). May phosphorylate CNN1, to contribute to the enrichment of CNN1 on anaphase kinetochores (PubMed:22561345)
- source language
- en
- evidence codes
- evidenceCode
- ECO:0000250
- source
- UniProtKB
- id
- P04551
- evidenceCode
- ECO:0000269
- source
- PubMed
- id
- 14574415
- evidenceCode
- ECO:0000269
- source
- PubMed
- id
- 22156209
- evidenceCode
- ECO:0000269
- source
- PubMed
- id
- 22561345
- evidenceCode
- ECO:0000269
- source
- PubMed
- id
- 2664468
Evidence for this statement
Source annotation
Evidence codes qualify the annotation. This record is not a measurement of an illustrated specimen.
Sequence and version
P00546
Inspect structured data
- accession
- P00546
- name
- Cyclin-dependent kinase 1
- length
- 298
- entry version
- 248
- sequence version
- 1
- sequence
MSGELANYKRLEKVGEGTYGVVYKALDLRPGQGQRVVALKKIRLESEDEGVPSTAIREIS LLKELKDDNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEGIPKDQPLGADIVKKFMMQL CKGIAYCHSHRILHRDLKPQNLLINKDGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAP EVLLGGKQYSTGVDTWSIGCIFAEMCNRKPIFSGDSEIDQIFKIFRVLGTPNEAIWPDIV YLPDFKPSFPQWRRKDLSQVVPSLDPRGIDLLDKLLAYDPINRISARRAAIHPYFQES
Genes and domains
Cross-references supplied by UniProt
Inspect structured data
- gene symbols
- CDC28
- gene crossreferences
- database
- EnsemblFungi
- id
- YBR160W_mRNA
- properties
- key
- ProteinId
- value
- YBR160W
- key
- GeneId
- value
- YBR160W
- database
- GeneID
- id
- 852457
- properties
- key
- Description
- value
- -
- interpro domains
- provider
- interpro
- accession
- IPR050108
- name
- CDK
- provider
- interpro
- accession
- IPR011009
- name
- Kinase-like_dom_sf
- provider
- interpro
- accession
- IPR000719
- name
- Prot_kinase_dom
- provider
- interpro
- accession
- IPR017441
- name
- Protein_kinase_ATP_BS
- provider
- interpro
- accession
- IPR008271
- name
- Ser/Thr_kinase_AS
GO function annotations
A sample with evidence codes
Inspect structured data
Shown / materialized / in provider response: 12 / 147 / 150
| GO | Evidence | Publication or rule | Assigned by |
|---|---|---|---|
| GO:0000993 RNA polymerase II complex binding Molecular Function | ECO:0000314 enables | PMID:22689984 | SGD 20130807 |
| GO:0004672 protein kinase activity Molecular Function | ECO:0000256 enables | GO_REF:0000002 | InterPro 20260727 |
| GO:0004672 protein kinase activity Molecular Function | ECO:0007005 enables | PMID:16319894 | SGD 20181119 |
| GO:0004674 protein serine/threonine kinase activity Molecular Function | ECO:0000314 enables | PMID:12050115 | SGD 20200716 |
| GO:0004674 protein serine/threonine kinase activity Molecular Function | ECO:0000314 enables | PMID:16096060 | SGD 20191106 |
| GO:0004674 protein serine/threonine kinase activity Molecular Function | ECO:0000314 enables | PMID:17460120 | UniProt 20230925 |
| GO:0004674 protein serine/threonine kinase activity Molecular Function | ECO:0000314 enables | PMID:21498574 | SGD 20191106 |
| GO:0004674 protein serine/threonine kinase activity Molecular Function | ECO:0000315 enables | PMID:21841787 | SGD 20191106 |
| GO:0004674 protein serine/threonine kinase activity Molecular Function | ECO:0000314 enables | PMID:22156209 | UniProt 20210707 |
| GO:0004674 protein serine/threonine kinase activity Molecular Function | ECO:0000314 enables | PMID:22521784 | SGD 20191106 |
| GO:0004674 protein serine/threonine kinase activity Molecular Function | ECO:0000315 enables | PMID:22521784 | SGD 20191106 |
| GO:0004674 protein serine/threonine kinase activity Molecular Function | ECO:0000314 enables | PMID:22563681 | SGD 20191106 |
Evidence for this statement
Source annotation
- Gene Ontology Consortium / QuickGO · UniProtKB:P00546
- Gene Ontology Consortium / QuickGO · UniProtKB:P00546
These are source annotations, not independent proof of a causal mechanism. The complete captured responses are available as originals.
Research cited by the protein record
Bibliographic records
Inspect structured data
- source
- uniprot
- id
- P00546-citation-6361575
- title
- Primary structure homology between the product of yeast cell division control gene CDC28 and vertebrate oncogenes.
- pmid
- 6361575
- doi
- 10.1038/307183a0
- year
- 1984
- authors
- Lorincz A.T.
- Reed S.I.
- journal
- Nature
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/P00546.json
- source snapshot sha256
- 756c9d3a748d52b3d222d898051e3becd0ca99a1d8d56acba5224314e57256e2
- source
- uniprot
- id
- P00546-citation-7597849
- title
- Sequence analysis of a 5.6 kb fragment of chromosome II from Saccharomyces cerevisiae reveals two new open reading frames next to CDC28.
- pmid
- 7597849
- doi
- 10.1002/yea.320110508
- year
- 1995
- authors
- Baur S.
- Becker J.
- Li Z.
- Niegemann E.
- Wehner E.
- Wolter R.
- Brendel M.
- journal
- Yeast
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/P00546.json
- source snapshot sha256
- 756c9d3a748d52b3d222d898051e3becd0ca99a1d8d56acba5224314e57256e2
- source
- uniprot
- id
- P00546-citation-7813418
- title
- Complete DNA sequence of yeast chromosome II.
- pmid
- 7813418
- doi
- 10.1002/j.1460-2075.1994.tb06923.x
- year
- 1994
- authors
- Feldmann H.
- Aigle M.
- Aljinovic G.
- Andre B.
- Baclet M.C.
- Barthe C.
- Baur A.
- Becam A.-M.
- Biteau N.
- Boles E.
- Brandt T.
- Brendel M.
- Brueckner M.
- Bussereau F.
- Christiansen C.
- Contreras R.
- Crouzet M.
- Cziepluch C.
- Demolis N.
- Delaveau T.
- Doignon F.
- Domdey H.
- Duesterhus S.
- Dubois E.
- Dujon B.
- El Bakkoury M.
- Entian K.-D.
- Feuermann M.
- Fiers W.
- Fobo G.M.
- Fritz C.
- Gassenhuber J.
- Glansdorff N.
- Goffeau A.
- Grivell L.A.
- de Haan M.
- Hein C.
- Herbert C.J.
- Hollenberg C.P.
- Holmstroem K.
- Jacq C.
- Jacquet M.
- Jauniaux J.-C.
- Jonniaux J.-L.
- Kallesoee T.
- Kiesau P.
- Kirchrath L.
- Koetter P.
- Korol S.
- Liebl S.
- Logghe M.
- Lohan A.J.E.
- Louis E.J.
- Li Z.Y.
- Maat M.J.
- Mallet L.
- Mannhaupt G.
- Messenguy F.
- Miosga T.
- Molemans F.
- Mueller S.
- Nasr F.
- Obermaier B.
- Perea J.
- Pierard A.
- Piravandi E.
- Pohl F.M.
- Pohl T.M.
- Potier S.
- Proft M.
- Purnelle B.
- Ramezani Rad M.
- Rieger M.
- Rose M.
- Schaaff-Gerstenschlaeger I.
- Scherens B.
- Schwarzlose C.
- Skala J.
- Slonimski P.P.
- Smits P.H.M.
- Souciet J.-L.
- Steensma H.Y.
- Stucka R.
- Urrestarazu L.A.
- van der Aart Q.J.M.
- Van Dyck L.
- Vassarotti A.
- Vetter I.
- Vierendeels F.
- Vissers S.
- Wagner G.
- de Wergifosse P.
- Wolfe K.H.
- Zagulski M.
- Zimmermann F.K.
- Mewes H.-W.
- Kleine K.
- journal
- EMBO J.
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/P00546.json
- source snapshot sha256
- 756c9d3a748d52b3d222d898051e3becd0ca99a1d8d56acba5224314e57256e2
- source
- uniprot
- id
- P00546-citation-24374639
- title
- The reference genome sequence of Saccharomyces cerevisiae: Then and now.
- pmid
- 24374639
- doi
- 10.1534/g3.113.008995
- year
- 2014
- authors
- Engel S.R.
- Dietrich F.S.
- Fisk D.G.
- Binkley G.
- Balakrishnan R.
- Costanzo M.C.
- Dwight S.S.
- Hitz B.C.
- Karra K.
- Nash R.S.
- Weng S.
- Wong E.D.
- Lloyd P.
- Skrzypek M.S.
- Miyasato S.R.
- Simison M.
- Cherry J.M.
- journal
- G3 (Bethesda)
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/P00546.json
- source snapshot sha256
- 756c9d3a748d52b3d222d898051e3becd0ca99a1d8d56acba5224314e57256e2
- source
- uniprot
- id
- P00546-citation-14562106
- title
- Global analysis of protein expression in yeast.
- pmid
- 14562106
- doi
- 10.1038/nature02046
- year
- 2003
- authors
- Ghaemmaghami S.
- Huh W.-K.
- Bower K.
- Howson R.W.
- Belle A.
- Dephoure N.
- O'Shea E.K.
- Weissman J.S.
- journal
- Nature
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/P00546.json
- source snapshot sha256
- 756c9d3a748d52b3d222d898051e3becd0ca99a1d8d56acba5224314e57256e2
- source
- uniprot
- id
- P00546-citation-2664468
- title
- The Saccharomyces cerevisiae CKS1 gene, a homolog of the Schizosaccharomyces pombe suc1+ gene, encodes a subunit of the Cdc28 protein kinase complex.
- pmid
- 2664468
- doi
- 10.1128/mcb.9.5.2034-2041.1989
- year
- 1989
- authors
- Hadwiger J.A.
- Wittenberg C.
- Mendenhall M.D.
- Reed S.I.
- journal
- Mol. Cell. Biol.
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/P00546.json
- source snapshot sha256
- 756c9d3a748d52b3d222d898051e3becd0ca99a1d8d56acba5224314e57256e2
- source
- uniprot
- id
- P00546-citation-14574415
- title
- Targets of the cyclin-dependent kinase Cdk1.
- pmid
- 14574415
- doi
- 10.1038/nature02062
- year
- 2003
- authors
- Ubersax J.A.
- Woodbury E.L.
- Quang P.N.
- Paraz M.
- Blethrow J.D.
- Shah K.
- Shokat K.M.
- Morgan D.O.
- journal
- Nature
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/P00546.json
- source snapshot sha256
- 756c9d3a748d52b3d222d898051e3becd0ca99a1d8d56acba5224314e57256e2
- source
- uniprot
- id
- P00546-citation-15665377
- title
- Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway.
- pmid
- 15665377
- doi
- 10.1074/mcp.m400219-mcp200
- year
- 2005
- authors
- Gruhler A.
- Olsen J.V.
- Mohammed S.
- Mortensen P.
- Faergeman N.J.
- Mann M.
- Jensen O.N.
- journal
- Mol. Cell. Proteomics
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/P00546.json
- source snapshot sha256
- 756c9d3a748d52b3d222d898051e3becd0ca99a1d8d56acba5224314e57256e2
- source
- uniprot
- id
- P00546-citation-17330950
- title
- Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae.
- pmid
- 17330950
- doi
- 10.1021/pr060559j
- year
- 2007
- authors
- Li X.
- Gerber S.A.
- Rudner A.D.
- Beausoleil S.A.
- Haas W.
- Villen J.
- Elias J.E.
- Gygi S.P.
- journal
- J. Proteome Res.
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/P00546.json
- source snapshot sha256
- 756c9d3a748d52b3d222d898051e3becd0ca99a1d8d56acba5224314e57256e2
- source
- uniprot
- id
- P00546-citation-19779198
- title
- Global analysis of Cdk1 substrate phosphorylation sites provides insights into evolution.
- pmid
- 19779198
- doi
- 10.1126/science.1172867
- year
- 2009
- authors
- Holt L.J.
- Tuch B.B.
- Villen J.
- Johnson A.D.
- Gygi S.P.
- Morgan D.O.
- journal
- Science
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/P00546.json
- source snapshot sha256
- 756c9d3a748d52b3d222d898051e3becd0ca99a1d8d56acba5224314e57256e2
- source
- uniprot
- id
- P00546-citation-22156209
- title
- Restriction of histone gene transcription to S phase by phosphorylation of a chromatin boundary protein.
- pmid
- 22156209
- doi
- 10.1101/gad.173427.111
- year
- 2011
- authors
- Kurat C.F.
- Lambert J.P.
- van Dyk D.
- Tsui K.
- van Bakel H.
- Kaluarachchi S.
- Friesen H.
- Kainth P.
- Nislow C.
- Figeys D.
- Fillingham J.
- Andrews B.J.
- journal
- Genes Dev.
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/P00546.json
- source snapshot sha256
- 756c9d3a748d52b3d222d898051e3becd0ca99a1d8d56acba5224314e57256e2
- source
- uniprot
- id
- P00546-citation-22814378
- title
- N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
- pmid
- 22814378
- doi
- 10.1073/pnas.1210303109
- year
- 2012
- authors
- Van Damme P.
- Lasa M.
- Polevoda B.
- Gazquez C.
- Elosegui-Artola A.
- Kim D.S.
- De Juan-Pardo E.
- Demeyer K.
- Hole K.
- Larrea E.
- Timmerman E.
- Prieto J.
- Arnesen T.
- Sherman F.
- Gevaert K.
- Aldabe R.
- journal
- Proc. Natl. Acad. Sci. U.S.A.
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/P00546.json
- source snapshot sha256
- 756c9d3a748d52b3d222d898051e3becd0ca99a1d8d56acba5224314e57256e2
Evidence for this statement
Source annotation
Only metadata is shown. Article text has a separate reuse decision.
Organism in the UniProt record
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) · NCBI 559292Scientific profile →Your research question
Save the article to return to your question and this source version.
Plan a test
This is your research plan. Completing these fields does not confirm a hypothesis.
Sources and versions
An explanation grounded in the cited sources
- UniProt Consortium · P00546
2026-09-09T03:19:40.513463+00:00 · CC-BY-4.0
Provenance and original
- Source version
- entry 248; sequence 1
- Original SHA-256
- 756c9d3a748d52b3d222d898051e3becd0ca99a1d8d56acba5224314e57256e2
- Processing
- Unmodified provider response; selected fields are projected into the document.
- Version details
- Native entry and sequence versions retained.
- Gene Ontology Consortium / QuickGO · UniProtKB:P00546
2026-09-09T03:19:42.173834+00:00 · CC-BY-4.0
Provenance and original
- Original SHA-256
- 229c2003f0d30fc3b13f848e278fa539b51940f83fbdba2214ae5d1d074f17a8
- Processing
- Unmodified provider response; selected fields are projected into the document.
- Version details
- No native GO release was supplied; exact response hash and retrieval time are retained.
- Gene Ontology Consortium / QuickGO · UniProtKB:P00546
2026-09-09T03:19:43.425341+00:00 · CC-BY-4.0
Provenance and original
- Original SHA-256
- 61d1cb9baedf35f7e46c90404b1233f7cc2b88bcf35d6ee3bde2aedf19502253
- Processing
- Unmodified provider response; selected fields are projected into the document.
- Version details
- No native GO release was supplied; exact response hash and retrieval time are retained.
Inspect structured data
- Content version
- 65b33cde9b0d1e94b6dd837851860c9f541969765c2ef4d677dd5c1a79301302
- Source version
- research-20260909.1
- Updated
- 2026-09-09