· An explanation grounded in the cited sources
DnaA · P03004
On this page
Meet the protein
DnaA is UniProt protein record P03004 for Escherichia coli (strain K12) (NCBI 83333). The retained sequence contains 467 amino acids.
[1]What is known about function
Function and evidence from UniProt
Inspect structured data
- source text
- Plays an essential in the initiation and regulation of chromosomal replication. Binds in an ATP-dependent fashion to the origin of replication (oriC) to initiate formation of the DNA replication initiation complex once per cell cycle (PubMed:3036372). Binds the DnaA box (consensus sequence 5'-TTATC[CA]A[CA]A-3') and separates the double-stranded (ds)DNA (PubMed:3036372, PubMed:18216012). Forms a right-handed helical filament on oriC DNA; dsDNA binds to the exterior of the filament while single-stranded (ss)DNA is stabiized in the filament's interior (By similarity). The ATP-DnaA-oriC complex binds and stabilizes the upper strand of the AT-rich DNA unwinding element (DUE) (PubMed:18216012). Mutagenesis of residues that line the central pore blocks dsDNA strand separation (PubMed:18216012). Subsequent binding of DNA polymerase III subunits leads to replisome formation (PubMed:3036372, PubMed:18216012). The DnaA-ATP form converts to DnaA-ADP; once converted to ADP the protein cannot initiate replication, ensuring only 1 round of replication per cell cycle (PubMed:3036372). Binds ATP, ADP and dATP equally well, hydrolyzes ATP with a half-life of about 15 minutes, ATP hydrolysis is not required for pre-priming replisome formation, nucleotide exchange is very slow (PubMed:3036372). Binds acidic phospholipids (PubMed:9478970, PubMed:26272946). DnaA inhibits its own gene expression (PubMed:2981626) as well as that of other genes including dam, rpoH (PubMed:2540187), ftsA and mioC
- source language
- en
- evidence codes
- evidenceCode
- ECO:0000250
- source
- UniProtKB
- id
- O66659
- evidenceCode
- ECO:0000269
- source
- PubMed
- id
- 18216012
- evidenceCode
- ECO:0000269
- source
- PubMed
- id
- 2540187
- evidenceCode
- ECO:0000269
- source
- PubMed
- id
- 26272946
- evidenceCode
- ECO:0000269
- source
- PubMed
- id
- 2981626
- evidenceCode
- ECO:0000269
- source
- PubMed
- id
- 3036372
- evidenceCode
- ECO:0000269
- source
- PubMed
- id
- 9478970
Evidence for this statement
Source annotation
Evidence codes qualify the annotation. This record is not a measurement of an illustrated specimen.
Function and evidence from UniProt
Inspect structured data
- source text
- Also required for replication of some plasmid DNA; binds 4 DnaA boxes in the minimal plasmid RK2 replication origin (oriV)
- source language
- en
- evidence codes
- evidenceCode
- ECO:0000269
- source
- PubMed
- id
- 15878847
- evidenceCode
- ECO:0000269
- source
- PubMed
- id
- 9242693
Evidence for this statement
Source annotation
Evidence codes qualify the annotation. This record is not a measurement of an illustrated specimen.
Sequence and version
P03004
Inspect structured data
- accession
- P03004
- name
- Chromosomal replication initiator protein DnaA
- length
- 467
- entry version
- 211
- sequence version
- 2
- sequence
MSLSLWQQCLARLQDELPATEFSMWIRPLQAELSDNTLALYAPNRFVLDWVRDKYLNNIN GLLTSFCGADAPQLRFEVGTKPVTQTPQAAVTSNVAAPAQVAQTQPQRAAPSTRSGWDNV PAPAEPTYRSNVNVKHTFDNFVEGKSNQLARAAARQVADNPGGAYNPLFLYGGTGLGKTH LLHAVGNGIMARKPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYYRSVDALLIDDIQFF ANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELE TRVAILMKKADENDIRLPGEVAFFIAKRLRSNVRELEGALNRVIANANFTGRAITIDFVR EALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNH SLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLIRTLSS
Genes and domains
Cross-references supplied by UniProt
Inspect structured data
- gene symbols
- dnaA
- gene crossreferences
- database
- GeneID
- id
- 93778443
- properties
- key
- Description
- value
- -
- database
- GeneID
- id
- 948217
- properties
- key
- Description
- value
- -
- interpro domains
- provider
- interpro
- accession
- IPR003593
- name
- AAA+_ATPase
- provider
- interpro
- accession
- IPR001957
- name
- Chromosome_initiator_DnaA
- provider
- interpro
- accession
- IPR020591
- name
- Chromosome_initiator_DnaA-like
- provider
- interpro
- accession
- IPR018312
- name
- Chromosome_initiator_DnaA_CS
- provider
- interpro
- accession
- IPR013159
- name
- DnaA_C
- provider
- interpro
- accession
- IPR013317
- name
- DnaA_dom
- provider
- interpro
- accession
- IPR024633
- name
- DnaA_N_dom
- provider
- interpro
- accession
- IPR038454
- name
- DnaA_N_sf
- provider
- interpro
- accession
- IPR027417
- name
- P-loop_NTPase
- provider
- interpro
- accession
- IPR010921
- name
- Trp_repressor/repl_initiator
Evidence for this statement
Source annotation
A database cross-reference does not replace assembly and strain checks. P03004 belongs to K12 (83333); the prior gene profile belongs to MG1655 (511145). These taxa are not merged.
GO function annotations
A sample with evidence codes
Inspect structured data
Shown / materialized / in provider response: 12 / 54 / 54
| GO | Evidence | Publication or rule | Assigned by |
|---|---|---|---|
| GO:0006260 DNA replication Biological Process | ECO:0000315 acts_upstream_of_or_within | PMID:12068813 | EcoliWiki 20100503 |
| GO:0006275 regulation of DNA replication Biological Process | ECO:0000315 acts_upstream_of_or_within | PMID:12068813 | EcoliWiki 20100503 |
| GO:0003677 DNA binding Molecular Function | ECO:0000256 enables | GO_REF:0000002 | InterPro 20260727 |
| GO:0003677 DNA binding Molecular Function | ECO:0000314 enables | PMID:7615570 | EcoCyc 20110629 |
| GO:0003688 DNA replication origin binding Molecular Function | ECO:0000318 enables | GO_REF:0000033 | GO_Central 20260424 |
| GO:0003688 DNA replication origin binding Molecular Function | ECO:0000501 enables | GO_REF:0000120 | UniProt 20260727 |
| GO:0003688 DNA replication origin binding Molecular Function | ECO:0000315 enables | PMID:19833870 | EcoCyc 20110629 |
| GO:0005515 protein binding Molecular Function | ECO:0000353 enables | PMID:10972842 | IntAct 20260725 |
| GO:0005515 protein binding Molecular Function | ECO:0000353 enables | PMID:15690043 | IntAct 20260725 |
| GO:0005515 protein binding Molecular Function | ECO:0000353 enables | PMID:15690043 | IntAct 20260725 |
| GO:0005515 protein binding Molecular Function | ECO:0000353 enables | PMID:17699754 | IntAct 20260725 |
| GO:0005515 protein binding Molecular Function | ECO:0000353 enables | PMID:18179598 | IntAct 20260725 |
Evidence for this statement
Source annotation
These are source annotations, not independent proof of a causal mechanism. The complete captured responses are available as originals.
Research cited by the protein record
Bibliographic records
Inspect structured data
- source
- uniprot
- id
- P03004-citation-6296774
- title
- The nucleotide sequence of the dnaA gene and the first part of the dnaN gene of Escherichia coli K-12.
- pmid
- 6296774
- doi
- 10.1093/nar/10.22.7373
- year
- 1982
- authors
- Hansen E.B.
- Hansen F.G.
- von Meyenburg K.
- journal
- Nucleic Acids Res.
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/P03004.json
- source snapshot sha256
- 20b9ed0385942a0aebc3645f0f499a77e9aab0741218e2327ee80b6ae7590dca
- source
- uniprot
- id
- P03004-citation-6234204
- title
- Structural analysis of the dnaA and dnaN genes of Escherichia coli.
- pmid
- 6234204
- doi
- 10.1016/0378-1119(84)90253-1
- year
- 1984
- authors
- Ohmori H.
- Kimura M.
- Nagata T.
- Sakakibara Y.
- journal
- Gene
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/P03004.json
- source snapshot sha256
- 20b9ed0385942a0aebc3645f0f499a77e9aab0741218e2327ee80b6ae7590dca
- source
- uniprot
- id
- P03004-citation-7686882
- title
- DNA sequence and analysis of 136 kilobases of the Escherichia coli genome: organizational symmetry around the origin of replication.
- pmid
- 7686882
- doi
- 10.1006/geno.1993.1230
- year
- 1993
- authors
- Burland V.D.
- Plunkett G. III
- Daniels D.L.
- Blattner F.R.
- journal
- Genomics
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/P03004.json
- source snapshot sha256
- 20b9ed0385942a0aebc3645f0f499a77e9aab0741218e2327ee80b6ae7590dca
- source
- uniprot
- id
- P03004-citation-9278503
- title
- The complete genome sequence of Escherichia coli K-12.
- pmid
- 9278503
- doi
- 10.1126/science.277.5331.1453
- year
- 1997
- authors
- Blattner F.R.
- Plunkett G. III
- Bloch C.A.
- Perna N.T.
- Burland V.
- Riley M.
- Collado-Vides J.
- Glasner J.D.
- Rode C.K.
- Mayhew G.F.
- Gregor J.
- Davis N.W.
- Kirkpatrick H.A.
- Goeden M.A.
- Rose D.J.
- Mau B.
- Shao Y.
- journal
- Science
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/P03004.json
- source snapshot sha256
- 20b9ed0385942a0aebc3645f0f499a77e9aab0741218e2327ee80b6ae7590dca
- source
- uniprot
- id
- P03004-citation-16738553
- title
- Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.
- pmid
- 16738553
- doi
- 10.1038/msb4100049
- year
- 2006
- authors
- Hayashi K.
- Morooka N.
- Yamamoto Y.
- Fujita K.
- Isono K.
- Choi S.
- Ohtsubo E.
- Baba T.
- Wanner B.L.
- Mori H.
- Horiuchi T.
- journal
- Mol. Syst. Biol.
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/P03004.json
- source snapshot sha256
- 20b9ed0385942a0aebc3645f0f499a77e9aab0741218e2327ee80b6ae7590dca
- source
- uniprot
- id
- P03004-citation-6329723
- title
- The nucleotide sequence of the dnaA gene promoter and of the adjacent rpmH gene, coding for the ribosomal protein L34, of Escherichia coli.
- pmid
- 6329723
- doi
- 10.1002/j.1460-2075.1982.tb01294.x
- year
- 1982
- authors
- Hansen F.G.
- Hansen E.B.
- Atlung T.
- journal
- EMBO J.
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/P03004.json
- source snapshot sha256
- 20b9ed0385942a0aebc3645f0f499a77e9aab0741218e2327ee80b6ae7590dca
- source
- uniprot
- id
- P03004-citation-2981626
- title
- Autoregulation of the DNA replication gene dnaA in E. coli K-12.
- pmid
- 2981626
- doi
- 10.1016/0092-8674(85)90319-8
- year
- 1985
- authors
- Braun R.E.
- O'Day K.
- Wright A.
- journal
- Cell
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/P03004.json
- source snapshot sha256
- 20b9ed0385942a0aebc3645f0f499a77e9aab0741218e2327ee80b6ae7590dca
- source
- uniprot
- id
- P03004-citation-3036372
- title
- ATP activates dnaA protein in initiating replication of plasmids bearing the origin of the E. coli chromosome.
- pmid
- 3036372
- doi
- 10.1016/0092-8674(87)90221-2
- year
- 1987
- authors
- Sekimizu K.
- Bramhill D.
- Kornberg A.
- journal
- Cell
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/P03004.json
- source snapshot sha256
- 20b9ed0385942a0aebc3645f0f499a77e9aab0741218e2327ee80b6ae7590dca
- source
- uniprot
- id
- P03004-citation-2540187
- title
- dnaA protein regulates transcriptions of the rpoH gene of Escherichia coli.
- pmid
- 2540187
- doi
- 10.1016/s0021-9258(18)83238-0
- year
- 1989
- authors
- Wang Q.P.
- Kaguni J.M.
- journal
- J. Biol. Chem.
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/P03004.json
- source snapshot sha256
- 20b9ed0385942a0aebc3645f0f499a77e9aab0741218e2327ee80b6ae7590dca
- source
- uniprot
- id
- P03004-citation-9478970
- title
- Membrane-mediated release of nucleotide from an initiator of chromosomal replication, Escherichia coli DnaA, occurs with insertion of a distinct region of the protein into the lipid bilayer.
- pmid
- 9478970
- doi
- 10.1074/jbc.273.9.5167
- year
- 1998
- authors
- Garner J.
- Durrer P.
- Kitchen J.
- Brunner J.
- Crooke E.
- journal
- J. Biol. Chem.
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/P03004.json
- source snapshot sha256
- 20b9ed0385942a0aebc3645f0f499a77e9aab0741218e2327ee80b6ae7590dca
- source
- uniprot
- id
- P03004-citation-9674428
- title
- The initiator function of DnaA protein is negatively regulated by the sliding clamp of the E. coli chromosomal replicase.
- pmid
- 9674428
- doi
- 10.1016/s0092-8674(00)81222-2
- year
- 1998
- authors
- Katayama T.
- Kubota T.
- Kurokawa K.
- Crooke E.
- Sekimizu K.
- journal
- Cell
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/P03004.json
- source snapshot sha256
- 20b9ed0385942a0aebc3645f0f499a77e9aab0741218e2327ee80b6ae7590dca
- source
- uniprot
- id
- P03004-citation-9298644
- title
- Escherichia coli proteome analysis using the gene-protein database.
- pmid
- 9298644
- doi
- 10.1002/elps.1150180805
- year
- 1997
- authors
- VanBogelen R.A.
- Abshire K.Z.
- Moldover B.
- Olson E.R.
- Neidhardt F.C.
- journal
- Electrophoresis
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/P03004.json
- source snapshot sha256
- 20b9ed0385942a0aebc3645f0f499a77e9aab0741218e2327ee80b6ae7590dca
Evidence for this statement
Source annotation
Only metadata is shown. Article text has a separate reuse decision.
Organism in the UniProt record
Escherichia coli (strain K12) · NCBI 83333Scientific profile →Your research question
Save the article to return to your question and this source version.
Plan a test
This is your research plan. Completing these fields does not confirm a hypothesis.
Sources and versions
An explanation grounded in the cited sources
- UniProt Consortium · P03004
2026-09-09T03:19:40.940804+00:00 · CC-BY-4.0
Provenance and original
- Source version
- entry 211; sequence 2
- Original SHA-256
- 20b9ed0385942a0aebc3645f0f499a77e9aab0741218e2327ee80b6ae7590dca
- Processing
- Unmodified provider response; selected fields are projected into the document.
- Version details
- Native entry and sequence versions retained.
- Gene Ontology Consortium / QuickGO · UniProtKB:P03004
2026-09-09T03:20:28.660556+00:00 · CC-BY-4.0
Provenance and original
- Original SHA-256
- 30a929f57c0f50a1fe5ae1509981b7f62b7e077f02ef20ea6320183d3865f8ac
- Processing
- Unmodified provider response; selected fields are projected into the document.
- Version details
- No native GO release was supplied; exact response hash and retrieval time are retained.
Inspect structured data
- Content version
- 4ca9013788258528077a3a10283bf04535988685b887158aa302eba857fc1177
- Source version
- research-20260909.1
- Updated
- 2026-09-09