· An explanation grounded in the cited sources
FLC · Q9S7Q7
On this page
Meet the protein
FLC is UniProt protein record Q9S7Q7 for Arabidopsis thaliana (NCBI 3702). The retained sequence contains 196 amino acids.
[1]What is known about function
Function and evidence from UniProt
Inspect structured data
- source text
- Putative transcription factor that seems to play a central role in the regulation of flowering time in the late-flowering phenotype by interacting with 'FRIGIDA', the autonomous and the vernalization flowering pathways. Inhibits flowering by repressing 'SUPPRESSOR OF OVEREXPRESSION OF CONSTANS 1'. At elevated temperatures (e.g. 29 degrees Celsius), maintained at high levels in a JMJ30/JMJ32-dependent manner to prevent extreme precocious flowering (PubMed:25267112)
- source language
- en
- evidence codes
- evidenceCode
- ECO:0000269
- source
- PubMed
- id
- 10716723
- evidenceCode
- ECO:0000269
- source
- PubMed
- id
- 11283346
- evidenceCode
- ECO:0000269
- source
- PubMed
- id
- 19121105
- evidenceCode
- ECO:0000269
- source
- PubMed
- id
- 25267112
Evidence for this statement
Source annotation
Evidence codes qualify the annotation. This record is not a measurement of an illustrated specimen.
Sequence and version
Q9S7Q7
Inspect structured data
- accession
- Q9S7Q7
- name
- MADS-box protein FLOWERING LOCUS C
- length
- 196
- entry version
- 177
- sequence version
- 1
- sequence
MGRKKLEIKRIENKSSRQVTFSKRRNGLIEKARQLSVLCDASVALLVVSASGKLYSFSSG DNLVKILDRYGKQHADDLKALDHQSKALNYGSHYELLELVDSKLVGSNVKNVSIDALVQL EEHLETALSVTRAKKTELMLKLVENLKEKEKMLKEENQVLASQMENNHHVGAEAEMEMSP AGQISDNLPVTLPLLN
Genes and domains
Cross-references supplied by UniProt
Inspect structured data
- gene symbols
- FLC
- gene crossreferences
- database
- GeneID
- id
- 830878
- properties
- key
- Description
- value
- -
- interpro domains
- provider
- interpro
- accession
- IPR050142
- name
- MADS-box/MEF2_TF
- provider
- interpro
- accession
- IPR033896
- name
- MEF2-like_N
- provider
- interpro
- accession
- IPR002487
- name
- TF_Kbox
- provider
- interpro
- accession
- IPR002100
- name
- TF_MADSbox
- provider
- interpro
- accession
- IPR036879
- name
- TF_MADSbox_sf
GO function annotations
A sample with evidence codes
Inspect structured data
Shown / materialized / in provider response: 12 / 30 / 30
| GO | Evidence | Publication or rule | Assigned by |
|---|---|---|---|
| GO:0009266 response to temperature stimulus Biological Process | ECO:0000315 acts_upstream_of_or_within | PMID:16473970 | TAIR 20060331 |
| GO:0009910 negative regulation of flower development Biological Process | ECO:0000315 acts_upstream_of_or_within | PMID:12114624 | TAIR 20060331 |
| GO:0010048 vernalization response Biological Process | ECO:0000270 acts_upstream_of_or_within | PMID:15734903 | TAIR 20060331 |
| GO:0042752 regulation of circadian rhythm Biological Process | ECO:0000315 acts_upstream_of_or_within | PMID:16473970 | TAIR 20060331 |
| GO:0000976 transcription cis-regulatory region binding Molecular Function | ECO:0000353 enables | PMID:30356219 | TAIR 20201218 |
| GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding Molecular Function | ECO:0000256 enables | GO_REF:0000002 | InterPro 20260727 |
| GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function | ECO:0000318 enables | GO_REF:0000033 | GO_Central 20220414 |
| GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function | ECO:0000318 enables | GO_REF:0000033 | GO_Central 20170829 |
| GO:0003677 DNA binding Molecular Function | ECO:0000256 enables | GO_REF:0000002 | InterPro 20260727 |
| GO:0003700 DNA-binding transcription factor activity Molecular Function | ECO:0000256 enables | GO_REF:0000002 | InterPro 20260727 |
| GO:0003700 DNA-binding transcription factor activity Molecular Function | ECO:0000304 enables | PMID:10716723 | TAIR 20050218 |
| GO:0003700 DNA-binding transcription factor activity Molecular Function | ECO:0000250 enables | PMID:11118137 | TAIR 20030606 |
Evidence for this statement
Source annotation
These are source annotations, not independent proof of a causal mechanism. The complete captured responses are available as originals.
Research cited by the protein record
Bibliographic records
Inspect structured data
- source
- uniprot
- id
- Q9S7Q7-citation-10072403
- title
- The FLF MADS box gene: a repressor of flowering in Arabidopsis regulated by vernalization and methylation.
- pmid
- 10072403
- doi
- 10.1105/tpc.11.3.445
- year
- 1999
- authors
- Sheldon C.C.
- Burn J.E.
- Perez P.P.
- Metzger J.
- Edwards J.A.
- Peacock W.J.
- Dennis E.S.
- journal
- Plant Cell
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/Q9S7Q7.json
- source snapshot sha256
- 2159cce16879e4d5f2b04e2fda6b73b07f5d70e9257555babf2bc9ee7f701aac
- source
- uniprot
- id
- Q9S7Q7-citation-10330478
- title
- FLOWERING LOCUS C encodes a novel MADS domain protein that acts as a repressor of flowering.
- pmid
- 10330478
- doi
- 10.1105/tpc.11.5.949
- year
- 1999
- authors
- Michaels S.D.
- Amasino R.M.
- journal
- Plant Cell
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/Q9S7Q7.json
- source snapshot sha256
- 2159cce16879e4d5f2b04e2fda6b73b07f5d70e9257555babf2bc9ee7f701aac
- source
- uniprot
- id
- Q9S7Q7-citation-11130714
- title
- Sequence and analysis of chromosome 5 of the plant Arabidopsis thaliana.
- pmid
- 11130714
- doi
- 10.1038/35048507
- year
- 2000
- authors
- Tabata S.
- Kaneko T.
- Nakamura Y.
- Kotani H.
- Kato T.
- Asamizu E.
- Miyajima N.
- Sasamoto S.
- Kimura T.
- Hosouchi T.
- Kawashima K.
- Kohara M.
- Matsumoto M.
- Matsuno A.
- Muraki A.
- Nakayama S.
- Nakazaki N.
- Naruo K.
- Okumura S.
- Shinpo S.
- Takeuchi C.
- Wada T.
- Watanabe A.
- Yamada M.
- Yasuda M.
- Sato S.
- de la Bastide M.
- Huang E.
- Spiegel L.
- Gnoj L.
- O'Shaughnessy A.
- Preston R.
- Habermann K.
- Murray J.
- Johnson D.
- Rohlfing T.
- Nelson J.
- Stoneking T.
- Pepin K.
- Spieth J.
- Sekhon M.
- Armstrong J.
- Becker M.
- Belter E.
- Cordum H.
- Cordes M.
- Courtney L.
- Courtney W.
- Dante M.
- Du H.
- Edwards J.
- Fryman J.
- Haakensen B.
- Lamar E.
- Latreille P.
- Leonard S.
- Meyer R.
- Mulvaney E.
- Ozersky P.
- Riley A.
- Strowmatt C.
- Wagner-McPherson C.
- Wollam A.
- Yoakum M.
- Bell M.
- Dedhia N.
- Parnell L.
- Shah R.
- Rodriguez M.
- Hoon See L.
- Vil D.
- Baker J.
- Kirchoff K.
- Toth K.
- King L.
- Bahret A.
- Miller B.
- Marra M.A.
- Martienssen R.
- McCombie W.R.
- Wilson R.K.
- Murphy G.
- Bancroft I.
- Volckaert G.
- Wambutt R.
- Duesterhoeft A.
- Stiekema W.
- Pohl T.
- Entian K.-D.
- Terryn N.
- Hartley N.
- Bent E.
- Johnson S.
- Langham S.-A.
- McCullagh B.
- Robben J.
- Grymonprez B.
- Zimmermann W.
- Ramsperger U.
- Wedler H.
- Balke K.
- Wedler E.
- Peters S.
- van Staveren M.
- Dirkse W.
- Mooijman P.
- Klein Lankhorst R.
- Weitzenegger T.
- Bothe G.
- Rose M.
- Hauf J.
- Berneiser S.
- Hempel S.
- Feldpausch M.
- Lamberth S.
- Villarroel R.
- Gielen J.
- Ardiles W.
- Bents O.
- Lemcke K.
- Kolesov G.
- Mayer K.F.X.
- Rudd S.
- Schoof H.
- Schueller C.
- Zaccaria P.
- Mewes H.-W.
- Bevan M.
- Fransz P.F.
- journal
- Nature
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/Q9S7Q7.json
- source snapshot sha256
- 2159cce16879e4d5f2b04e2fda6b73b07f5d70e9257555babf2bc9ee7f701aac
- source
- uniprot
- id
- Q9S7Q7-citation-27862469
- title
- Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
- pmid
- 27862469
- doi
- 10.1111/tpj.13415
- year
- 2017
- authors
- Cheng C.Y.
- Krishnakumar V.
- Chan A.P.
- Thibaud-Nissen F.
- Schobel S.
- Town C.D.
- journal
- Plant J.
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/Q9S7Q7.json
- source snapshot sha256
- 2159cce16879e4d5f2b04e2fda6b73b07f5d70e9257555babf2bc9ee7f701aac
- source
- uniprot
- id
- Q9S7Q7-citation-CI-CI4AM1G71UC0S
- title
- Community-consensus reference genome of Arabidopsis thaliana Col-0.
- pmid
- —
- doi
- —
- year
- FEB-
- authors
- journal
- —
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/Q9S7Q7.json
- source snapshot sha256
- 2159cce16879e4d5f2b04e2fda6b73b07f5d70e9257555babf2bc9ee7f701aac
- source
- uniprot
- id
- Q9S7Q7-citation-10716723
- title
- The molecular basis of vernalization: the central role of FLOWERING LOCUS C (FLC).
- pmid
- 10716723
- doi
- 10.1073/pnas.97.7.3753
- year
- 2000
- authors
- Sheldon C.C.
- Rouse D.T.
- Finnegan E.J.
- Peacock W.J.
- Dennis E.S.
- journal
- Proc. Natl. Acad. Sci. U.S.A.
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/Q9S7Q7.json
- source snapshot sha256
- 2159cce16879e4d5f2b04e2fda6b73b07f5d70e9257555babf2bc9ee7f701aac
- source
- uniprot
- id
- Q9S7Q7-citation-11283346
- title
- Loss of flowering locus c activity eliminates the late-flowering phenotype of frigida and autonomous pathway mutations but not responsiveness to vernalization.
- pmid
- 11283346
- doi
- 10.1105/tpc.13.4.935
- year
- 2001
- authors
- Michaels S.D.
- Amasino R.M.
- journal
- Plant Cell
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/Q9S7Q7.json
- source snapshot sha256
- 2159cce16879e4d5f2b04e2fda6b73b07f5d70e9257555babf2bc9ee7f701aac
- source
- uniprot
- id
- Q9S7Q7-citation-14593187
- title
- Regulation of flowering time by histone acetylation in Arabidopsis.
- pmid
- 14593187
- doi
- 10.1126/science.1091109
- year
- 2003
- authors
- He Y.
- Michaels S.D.
- Amasino R.M.
- journal
- Science
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/Q9S7Q7.json
- source snapshot sha256
- 2159cce16879e4d5f2b04e2fda6b73b07f5d70e9257555babf2bc9ee7f701aac
- source
- uniprot
- id
- Q9S7Q7-citation-14712276
- title
- Vernalization in Arabidopsis thaliana is mediated by the PHD finger protein VIN3.
- pmid
- 14712276
- doi
- 10.1038/nature02195
- year
- 2004
- authors
- Sung S.
- Amasino R.M.
- journal
- Nature
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/Q9S7Q7.json
- source snapshot sha256
- 2159cce16879e4d5f2b04e2fda6b73b07f5d70e9257555babf2bc9ee7f701aac
- source
- uniprot
- id
- Q9S7Q7-citation-16299497
- title
- Prevention of early flowering by expression of FLOWERING LOCUS C requires methylation of histone H3 K36.
- pmid
- 16299497
- doi
- 10.1038/ncb1329
- year
- 2005
- authors
- Zhao Z.
- Yu Y.
- Meyer D.
- Wu C.
- Shen W.-H.
- journal
- Nat. Cell Biol.
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/Q9S7Q7.json
- source snapshot sha256
- 2159cce16879e4d5f2b04e2fda6b73b07f5d70e9257555babf2bc9ee7f701aac
- source
- uniprot
- id
- Q9S7Q7-citation-15659097
- title
- HUA2 is required for the expression of floral repressors in Arabidopsis thaliana.
- pmid
- 15659097
- doi
- 10.1111/j.1365-313x.2004.02300.x
- year
- 2005
- authors
- Doyle M.R.
- Bizzell C.M.
- Keller M.R.
- Michaels S.D.
- Song J.
- Noh Y.-S.
- Amasino R.M.
- journal
- Plant J.
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/Q9S7Q7.json
- source snapshot sha256
- 2159cce16879e4d5f2b04e2fda6b73b07f5d70e9257555babf2bc9ee7f701aac
- source
- uniprot
- id
- Q9S7Q7-citation-17996704
- title
- The Arabidopsis RNA-binding protein FCA requires a lysine-specific demethylase 1 homolog to downregulate FLC.
- pmid
- 17996704
- doi
- 10.1016/j.molcel.2007.10.018
- year
- 2007
- authors
- Liu F.
- Quesada V.
- Crevillen P.
- Baeurle I.
- Swiezewski S.
- Dean C.
- journal
- Mol. Cell
- rights reuse state
- metadata_only
- source url
- https://rest.uniprot.org/uniprotkb/Q9S7Q7.json
- source snapshot sha256
- 2159cce16879e4d5f2b04e2fda6b73b07f5d70e9257555babf2bc9ee7f701aac
Evidence for this statement
Source annotation
Only metadata is shown. Article text has a separate reuse decision.
Organism in the UniProt record
Arabidopsis thaliana · NCBI 3702Scientific profile →Your research question
Save the article to return to your question and this source version.
Plan a test
This is your research plan. Completing these fields does not confirm a hypothesis.
Sources and versions
An explanation grounded in the cited sources
- UniProt Consortium · Q9S7Q7
2026-09-09T03:19:39.769546+00:00 · CC-BY-4.0
Provenance and original
- Source version
- entry 177; sequence 1
- Original SHA-256
- 2159cce16879e4d5f2b04e2fda6b73b07f5d70e9257555babf2bc9ee7f701aac
- Processing
- Unmodified provider response; selected fields are projected into the document.
- Version details
- Native entry and sequence versions retained.
- Gene Ontology Consortium / QuickGO · UniProtKB:Q9S7Q7
2026-09-09T03:19:40.604412+00:00 · CC-BY-4.0
Provenance and original
- Original SHA-256
- 1bce19d629054daf9bef55482bbda7cd9c4aa6574d0cff5042e009bcd053d026
- Processing
- Unmodified provider response; selected fields are projected into the document.
- Version details
- No native GO release was supplied; exact response hash and retrieval time are retained.
Inspect structured data
- Content version
- bf92accd5cfbe3ddab3a785f1aa991d31e095748b25c1cab9fe3d4c30553f030
- Source version
- research-20260909.1
- Updated
- 2026-09-09